PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008239671.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB
Protein Properties Length: 360aa    MW: 40429.8 Da    PI: 6.3745
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008239671.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.31.7e-131461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +++    ++G+ +W++ +++ g++R++k+c++rw +yl
   XP_008239671.1 14 RGLWTEEEDAKILAHGSKHGNSNWTAFPKKAGLTRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding42.51.5e-1369110346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T+ E+el+v++++  G++ W  Ia+ ++ gRt+k++k++w++
   XP_008239671.1  69 SFTPHEEELIVRLHATIGSR-WPIIAQQLP-GRTDKDVKNYWNT 110
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-21664IPR009057Homeodomain-like
PROSITE profilePS5129413.653961IPR017930Myb domain
SuperFamilySSF466898.44E-2612108IPR009057Homeodomain-like
SMARTSM007171.6E-91363IPR001005SANT/Myb domain
PfamPF002491.8E-121461IPR001005SANT/Myb domain
CDDcd001672.00E-81761No hitNo description
PROSITE profilePS5129420.95862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-2365116IPR009057Homeodomain-like
SMARTSM007178.9E-1366114IPR001005SANT/Myb domain
CDDcd001671.68E-969112No hitNo description
PfamPF002499.9E-1269110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MVRPACCEKL HLKRGLWTEE EDAKILAHGS KHGNSNWTAF PKKAGLTRCG KSCRLRWTNY  60
LRPNLKHESF TPHEEELIVR LHATIGSRWP IIAQQLPGRT DKDVKNYWNT KLKKKLSEMG  120
IDHVTHKPFS QILADYGNIG GLPKAGMRMA IGSLNKDLKN AILMKPELPY SLSTHGFSSI  180
NSHLMPMTMT PIKREPIQDG FLSNAQSSNQ PFDLLTQLQA IRLVTEASNS TNIESSPPNL  240
YIPEGTLSSS PSSSTCSSAA QEQATLQAFS WSDFLLEDAF FPTCDAQEHE DKAEHSSMDM  300
LNQSKAAIPQ SQIEDQAGMQ KYNEVEATSP CDSSFVEAMV ARENEMFLEF PQLMEEPFYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008239671.10.0PREDICTED: transcription factor MYB51
RefseqXP_008239672.10.0PREDICTED: transcription factor MYB51
TrEMBLM5WT280.0M5WT28_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s07900.11e-135(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.12e-68MYB family protein